PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013619075.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family MYB
Protein Properties Length: 355aa    MW: 39833.3 Da    PI: 6.7497
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013619075.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.11.7e-1762109148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g+WT+eEd +l+ +v+++G g W+t + + g++R++k+c++rw +yl
   XP_013619075.1  62 KGAWTQEEDHKLIAYVQLHGEGGWRTLPDKAGLRRCGKSCRLRWANYL 109
                      79********************************************97 PP

2Myb_DNA-binding56.28.1e-18115159147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg +++eE++ ++++++ +G++ W++Iar+++ gRt++++k++w+++
   XP_013619075.1 115 RGEFSEEEQDSIIRLHAIHGNK-WSAIARRLP-GRTDNEIKNHWNTH 159
                      899*******************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.0E-2353112IPR009057Homeodomain-like
PROSITE profilePS5129417.37357109IPR017930Myb domain
SuperFamilySSF466892.78E-2959156IPR009057Homeodomain-like
SMARTSM007171.2E-1161111IPR001005SANT/Myb domain
PfamPF002492.2E-1562109IPR001005SANT/Myb domain
CDDcd001671.52E-864109No hitNo description
PROSITE profilePS5129426.682110164IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.5E-26113165IPR009057Homeodomain-like
SMARTSM007173.9E-17114162IPR001005SANT/Myb domain
PfamPF002493.1E-16115159IPR001005SANT/Myb domain
CDDcd001671.12E-12117160No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 355 aa     Download sequence    Send to blast
MFSSKDQVLP SYDPTQNHNT LISLSLSLSL SLSLSLTSVI TITNQDSRMV RTPCCRAEGL  60
KKGAWTQEED HKLIAYVQLH GEGGWRTLPD KAGLRRCGKS CRLRWANYLR PDIKRGEFSE  120
EEQDSIIRLH AIHGNKWSAI ARRLPGRTDN EIKNHWNTHI KKRLVKKGID PLTHKSLNGK  180
SSDHTETPPD KSSVHQDDDD QKSNKNNALG SLSARFLNRV ANRFGKRINH SVLSDIINGS  240
GAPFTSHTTP TTSASECEKS SSSFSTPNSS NLLINENMVL DATSLSSSTF SSDTSDPSVY  300
DHIFDDLEDM TTFSSRFLND VVSHDDVDFL MLDESCLENT SFMRELTRIL QEDYV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-28601645108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ6701200.0KJ670120.1 Brassica napus MYB transcription factor 122 (MYB122.1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013619075.10.0PREDICTED: transcription factor MYB122 isoform X1
SwissprotQ9C9C81e-151MY122_ARATH; Transcription factor MYB122
TrEMBLA0A0D3AQF40.0A0A0D3AQF4_BRAOL; Uncharacterized protein
STRINGBra008131.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G74080.11e-135myb domain protein 122